PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01760.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 338aa    MW: 36671.7 Da    PI: 8.0329
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01760.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.11.1e-191865148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WTt+Ed+llv+ v+q+G g+W++++++ g++R++k+c++rw +yl
  Zmw_sc01760.1.g00200.1.am.mk 18 KGPWTTQEDKLLVEHVQQHGEGRWNSVSKHTGLKRSGKSCRLRWVNYL 65
                                  79********************************************97 PP

2Myb_DNA-binding53.94.3e-1771115147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  Zmw_sc01760.1.g00200.1.am.mk  71 RGKITPQEESIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 115
                                   8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6141365IPR017930Myb domain
SuperFamilySSF466891.01E-2916112IPR009057Homeodomain-like
SMARTSM007179.3E-171767IPR001005SANT/Myb domain
PfamPF002493.0E-181865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-241972IPR009057Homeodomain-like
CDDcd001673.44E-122065No hitNo description
PROSITE profilePS5129425.39666120IPR017930Myb domain
SMARTSM007176.6E-1670118IPR001005SANT/Myb domain
PfamPF002491.3E-1471115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-2473118IPR009057Homeodomain-like
CDDcd001671.78E-1075116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEEGQLAWGG REVDGWRKGP WTTQEDKLLV EHVQQHGEGR WNSVSKHTGL KRSGKSCRLR  60
WVNYLRPDLK RGKITPQEES IIVQLHALWG NRWSTIARSL PGRTDNEIKN YWRTHFKKGK  120
PSKNIERARA RFLKQRREMQ IQQQQQLQQL ISKVDENTNH DDGATRCGTL VEAEDRGSAV  180
VDNACAGTTA AAVTDQSSGQ HHQAAAPDLA MHDAMMDFMC PMSCGLLLHG AGGHQGGASA  240
GSCCGSTSEE YGSSEEDGAT WGSLWNLEDV VGDGGGPGAY AWGRRQRSIA RGGEGARCSY  300
KRASADSAAA VVLVDNDVGT TTAVLPLRSS SSSGSGLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-281811827126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-121PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-121K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-121(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584